PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_343F2D219.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 247aa    MW: 26784.9 Da    PI: 6.2449
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_343F2D219.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.4e-171663148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g W++eEde+l++ + ++G g+W++++r  g++R++k+c++rw +yl
  Traes_1AL_343F2D219.1 16 KGLWSPEEDEKLYNHIIRHGVGCWSSVPRLAGLNRCGKSCRLRWINYL 63
                           678*******************************************97 PP

2Myb_DNA-binding52.21.4e-1669112146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg +++eE++ +v +++ lG++ W+ Ia++++ gRt++++k++w++
  Traes_1AL_343F2D219.1  69 RGCFSQEEEDHIVALHQILGNR-WSQIASHLP-GRTDNEIKNFWNS 112
                            899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-231166IPR009057Homeodomain-like
PROSITE profilePS5129418.451163IPR017930Myb domain
SuperFamilySSF466891.88E-2913110IPR009057Homeodomain-like
SMARTSM007178.4E-141565IPR001005SANT/Myb domain
PfamPF002492.5E-151663IPR001005SANT/Myb domain
CDDcd001672.42E-121963No hitNo description
PROSITE profilePS5129424.74764118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2567118IPR009057Homeodomain-like
SMARTSM007175.7E-1468116IPR001005SANT/Myb domain
PfamPF002491.9E-1469112IPR001005SANT/Myb domain
CDDcd001673.89E-1172111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGRPSSGGVG QPKLRKGLWS PEEDEKLYNH IIRHGVGCWS SVPRLAGLNR CGKSCRLRWI  60
NYLRPDLKRG CFSQEEEDHI VALHQILGNR WSQIASHLPG RTDNEIKNFW NSCIKKKLRQ  120
QGLDPATHKP MAAADTATPA LPDTEEEDRK PLAAAADGSL APKQTAVFDP FPVCADYGAR  180
FAEDLGAANA AALYGQFYGG KEAADEDAGF GAADYSCVLD VPESLGYGES SSNSSNRNYG  240
GEVGSML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-29101181108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0669460.0KM066946.1 Triticum aestivum R2R3-MYB transcription factor (MYB86) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961344.11e-121PREDICTED: myb-related protein Hv33-like
SwissprotP200271e-151MYB3_HORVU; Myb-related protein Hv33
TrEMBLW4ZN670.0W4ZN67_WHEAT; Uncharacterized protein
STRINGSi022730m1e-120(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-70myb domain protein 86
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]